SCOP 1.75: Domain d1ampa_: 1amp A:

Lineage for d1ampa_ (1amp A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (9 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (17 proteins)

6. Protein Aminopeptidase [53205] (2 species)

7. Species Aeromonas proteolytica [TaxId:671] [53206] (13 PDB entries)
   Uniprot Q01693
   synonym: Vibrio proteolyticus

8. Domain d1ampa_: 1amp A: [33837]
   complexed with zn

Details for d1ampa_

PDB Entry: 1amp, 1.8 Å

PDB Description: crystal structure of aeromonas proteolytica aminopeptidase: a prototypical member of the co-catalytic zinc enzyme family

PDB Compounds: (A:) aminopeptidase

SCOP Domain Sequences for d1ampa_:

Sequence; same for both SEQRES and ATOM records:

>d1ampa_ c.56.5.4 (A:) Aminopeptidase {Aeromonas proteolytica [TaxId: 671]}
mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas
giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm
tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa
ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg

Timeline for d1ampa_:

• d1ampa_ first appeared (with stable ids) in SCOP 1.55, called d1amp__
  
• d1ampa_ appears in SCOP 1.73
  
• d1ampa_ appears in SCOPe 2.01
  
• d1ampa_ appears in the current release, SCOPe 2.08