Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (6 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (9 proteins) |
Protein Aminopeptidase [53205] (2 species) |
Species Aeromonas proteolytica [TaxId:671] [53206] (7 PDB entries) synonym: Vibrio proteolyticus |
Domain d1amp__: 1amp - [33837] |
PDB Entry: 1amp (more details), 1.8 Å
SCOP Domain Sequences for d1amp__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1amp__ c.56.5.4 (-) Aminopeptidase {Aeromonas proteolytica} mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg
Timeline for d1amp__: