SCOP 1.67: Domain d1amp__: 1amp -

Lineage for d1amp__ (1amp -)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (6 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (9 proteins)

6. Protein Aminopeptidase [53205] (2 species)

7. Species Aeromonas proteolytica [TaxId:671] [53206] (6 PDB entries)
   synonym: Vibrio proteolyticus

8. Domain d1amp__: 1amp - [33837]
   complexed with zn

Details for d1amp__

PDB Entry: 1amp, 1.8 Å

PDB Description: crystal structure of aeromonas proteolytica aminopeptidase: a prototypical member of the co-catalytic zinc enzyme family

SCOP Domain Sequences for d1amp__:

Sequence; same for both SEQRES and ATOM records:

>d1amp__ c.56.5.4 (-) Aminopeptidase {Aeromonas proteolytica}
mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas
giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm
tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa
ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg

Timeline for d1amp__:

• d1amp__ first appeared (with stable ids) in SCOP 1.55
  
• d1amp__ appears in SCOP 1.65
  
• d1amp__ appears in SCOP 1.69
  
• d1amp__ appears in the current release, SCOPe 2.08, called d1ampa_