Lineage for d1amp__ (1amp -)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 124810Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 124952Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) (S)
  5. 125014Family c.56.5.4: Bacterial exopeptidases [53204] (2 proteins)
  6. 125015Protein Aminopeptidase [53205] (2 species)
  7. 125016Species Aeromonas proteolytica [TaxId:671] [53206] (4 PDB entries)
  8. 125017Domain d1amp__: 1amp - [33837]

Details for d1amp__

PDB Entry: 1amp (more details), 1.8 Å

PDB Description: crystal structure of aeromonas proteolytica aminopeptidase: a prototypical member of the co-catalytic zinc enzyme family

SCOP Domain Sequences for d1amp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1amp__ c.56.5.4 (-) Aminopeptidase {Aeromonas proteolytica}
mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas
giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm
tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa
ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg

SCOP Domain Coordinates for d1amp__:

Click to download the PDB-style file with coordinates for d1amp__.
(The format of our PDB-style files is described here.)

Timeline for d1amp__: