Lineage for d1amp__ (1amp -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) 
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) 
Family c.56.5.4: Bacterial exopeptidases [53204] (2 proteins) Protein Aminopeptidase [53205] (2 species) 
Species Aeromonas proteolytica [TaxId:671] [53206] (4 PDB entries) 
Domain d1amp__: 1amp - [33837]
Details for d1amp__
PDB Entry: 1amp (more details), 1.8 Å
PDB Description: crystal structure of aeromonas proteolytica aminopeptidase: a prototypical member of the co-catalytic zinc enzyme family
SCOP Domain Sequences for d1amp__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1amp__ c.56.5.4 (-) Aminopeptidase {Aeromonas proteolytica}
mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas
giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm
tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa
ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg
SCOP Domain Coordinates for d1amp__:
Click to download the PDB-style file with coordinates for d1amp__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1amp__:
- d1amp__ appears in SCOP 1.57
- d1amp__ appears in the current release, SCOPe 2.08, called d1ampa_
View in 3D