Lineage for d5v9lc1 (5v9l C:1-168)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2125254Protein automated matches [190047] (29 species)
    not a true protein
  7. 2125340Species Human (Homo sapiens) [TaxId:9606] [186768] (179 PDB entries)
  8. 2125549Domain d5v9lc1: 5v9l C:1-168 [338298]
    Other proteins in same PDB: d5v9la2, d5v9lb2, d5v9lc2
    automated match to d4obea_
    complexed with 91d, gdp, mg

Details for d5v9lc1

PDB Entry: 5v9l (more details), 1.98 Å

PDB Description: kras g12c in bound to quinazoline based switch ii pocket (swiip) binder
PDB Compounds: (C:) GTPase KRas

SCOPe Domain Sequences for d5v9lc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v9lc1 c.37.1.8 (C:1-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke

SCOPe Domain Coordinates for d5v9lc1:

Click to download the PDB-style file with coordinates for d5v9lc1.
(The format of our PDB-style files is described here.)

Timeline for d5v9lc1: