Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (2 proteins) contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1) automatically mapped to Pfam PF02664 |
Protein automated matches [323957] (1 species) not a true protein |
Species Salmonella typhi [TaxId:90370] [323958] (2 PDB entries) |
Domain d5v2wb1: 5v2w B:3-171 [338279] Other proteins in same PDB: d5v2wb2 automated match to d1j6wb_ complexed with zn |
PDB Entry: 5v2w (more details), 2.3 Å
SCOPe Domain Sequences for d5v2wb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5v2wb1 d.185.1.2 (B:3-171) automated matches {Salmonella typhi [TaxId: 90370]} lldsfavdhtrmqapavrtaktmntphgdaitvfdlrfcipnkevmpekgihtlehlfag fmrdhlngngveiidispmgcrtgfymsligtpdeqrvadawkaamadvlkvqdqnqipe lnvyqcgtyqmhslseaqdiarhilerdvrvnsnkelalpkeklqelhi
Timeline for d5v2wb1: