SCOPe 2.08: Domain d5v2wb1: 5v2w B:3-171

Lineage for d5v2wb1 (5v2w B:3-171)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (2 proteins)
   contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1)
   automatically mapped to Pfam PF02664

6. Protein automated matches [323957] (1 species)
   not a true protein

7. Species Salmonella typhi [TaxId:90370] [323958] (2 PDB entries)

8. Domain d5v2wb1: 5v2w B:3-171 [338279]
   Other proteins in same PDB: d5v2wb2
   automated match to d1j6wb_
   complexed with zn

Details for d5v2wb1

PDB Entry: 5v2w, 2.3 Å

PDB Description: crystal structure of a luxs from salmonella typhi

PDB Compounds: (B:) S-ribosylhomocysteine lyase

SCOPe Domain Sequences for d5v2wb1:

Sequence; same for both SEQRES and ATOM records:

>d5v2wb1 d.185.1.2 (B:3-171) automated matches {Salmonella typhi [TaxId: 90370]}
lldsfavdhtrmqapavrtaktmntphgdaitvfdlrfcipnkevmpekgihtlehlfag
fmrdhlngngveiidispmgcrtgfymsligtpdeqrvadawkaamadvlkvqdqnqipe
lnvyqcgtyqmhslseaqdiarhilerdvrvnsnkelalpkeklqelhi

Timeline for d5v2wb1:

• d5v2wb1 first appeared in SCOPe 2.06
  
• d5v2wb1 appears in SCOPe 2.07