Lineage for d5ucea_ (5uce A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2503865Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2503866Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2503891Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species)
  7. 2503914Species Streptococcus sp. [TaxId:1325] [338258] (3 PDB entries)
  8. 2503917Domain d5ucea_: 5uce A: [338264]
    automated match to d5bmgd_
    mutant

Details for d5ucea_

PDB Entry: 5uce (more details)

PDB Description: solution nmr structure of the major species of dancer-2, a dynamic and natively folded pentamutant of the b1 domain of streptococcal protein g (gb1)
PDB Compounds: (A:) Immunoglobulin G-binding protein G

SCOPe Domain Sequences for d5ucea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ucea_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp. [TaxId: 1325]}
mtfkaiingktlkgettteavdaataekvfkqyfndngldgewtyddatktftvte

SCOPe Domain Coordinates for d5ucea_:

Click to download the PDB-style file with coordinates for d5ucea_.
(The format of our PDB-style files is described here.)

Timeline for d5ucea_: