SCOPe 2.06: Domain d5oncb1: 5onc B:1-268

Lineage for d5oncb1 (5onc B:1-268)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (60 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [228163] (15 PDB entries)

8. Domain d5oncb1: 5onc B:1-268 [338237]
   Other proteins in same PDB: d5onca3
   automated match to d4wysa1
   complexed with cl

Details for d5oncb1

PDB Entry: 5onc, 2.19 Å

PDB Description: catabolism of the cholesterol side chain in mycobacterium tuberculosis is controlled by a redox-sensitive thiol switch

PDB Compounds: (B:) Steroid 3-ketoacyl-CoA thiolase

SCOPe Domain Sequences for d5oncb1:

Sequence, based on SEQRES records:

>d5oncb1 c.95.1.0 (B:1-268) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mgypviveatrspigkrngwlsglhatellgavqkavvdkagiqsglhagdveqviggcv
tqfgeqsnnisrvawltaglpehvgattvdcqcgsgqqanhliagliaagaidvgiacgi
eamsrvglganagpdrsliraqswdidlpnqfeaaeriakrrgitredvdvfglesqrra
qrawaegrfdreispiqapvldeqnqptgerrlvfrdqglrettmaglgelkpvleggih
tagtssqisdgaaavlwmdeavarahgl

Sequence, based on observed residues (ATOM records):

>d5oncb1 c.95.1.0 (B:1-268) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mgypviveatrspigkrngwlsglhatellgavqkavvdkagiqsglhagdveqviggcv
tqsnnisrvawltaglpehvgattvdcqcgsgqqanhliagliaagaidvgiacgieams
pnqfeaaeriakrrgitredvdvfglesqrraqrawaegrfdreispiqapvldeqnqpt
lvfrdqglrettmaglgelkpvleggihtagtssqisdgaaavlwmdeavarahgl

Timeline for d5oncb1:

• d5oncb1 is new in SCOPe 2.06-stable
  
• d5oncb1 appears in SCOPe 2.07
  
• d5oncb1 appears in the current release, SCOPe 2.08