Lineage for d5mifb_ (5mif B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2153556Species Tuber melanosporum [TaxId:656061] [338192] (2 PDB entries)
  8. 2153558Domain d5mifb_: 5mif B: [338232]
    automated match to d4v2ia_
    complexed with trt

Details for d5mifb_

PDB Entry: 5mif (more details), 2.14 Å

PDB Description: crystal structure of carboxyl esterase 2 (tmelest2) from mycorrhizal fungus tuber melanosporum
PDB Compounds: (B:) 'Carboxyl esterase 2

SCOPe Domain Sequences for d5mifb_:

Sequence, based on SEQRES records: (download)

>d5mifb_ c.69.1.0 (B:) automated matches {Tuber melanosporum [TaxId: 656061]}
qldpitqayadaissrpslfafplpeirdgyqsnvsdpstefttkilslpvgptgnvtay
lykpvsgerekgkdllpviayfhgggwvfggpksyrglitnliresgaavffvdytltpk
vaypvpneqcyaavqwllehgeklgvdptnmgfggdsaggelsssvsllsikrktplpkf
qvliypatdlacesatfkefpngpglttdeirfaaslftpdpksrledvaspgrasdedl
akfpetlivvaevdpirqqgedfgrrlqklgvraaiirvlgtihgfasidvlseapgaka
tieligykfkkalh

Sequence, based on observed residues (ATOM records): (download)

>d5mifb_ c.69.1.0 (B:) automated matches {Tuber melanosporum [TaxId: 656061]}
qldpitqayadaissrpslfafplpeirdgyqsstefttkilslpvgptgnvtaylykpv
sdllpviayfhgggwvfggpksyrglitnliresgaavffvdytltpkvaypvpneqcya
avqwllehgeklgvdptnmgfggdsaggelsssvsllsikrktplpkfqvliypatdlac
esatfkefpngpglttdeirfaaslftpdpksrledvaspgrasdedlakfpetlivvae
vdpirqqgedfgrrlqklgvraaiirvlgtihgfasidvlseapgakatieligykfkka
lh

SCOPe Domain Coordinates for d5mifb_:

Click to download the PDB-style file with coordinates for d5mifb_.
(The format of our PDB-style files is described here.)

Timeline for d5mifb_: