Lineage for d5me7d1 (5me7 D:53-235)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962641Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2962642Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2962762Family d.86.1.0: automated matches [191459] (1 protein)
    not a true family
  6. 2962763Protein automated matches [190708] (10 species)
    not a true protein
  7. 2962774Species Cucumis melo [TaxId:3656] [338181] (3 PDB entries)
  8. 2962779Domain d5me7d1: 5me7 D:53-235 [338230]
    Other proteins in same PDB: d5me7a2, d5me7c2, d5me7d2
    automated match to d2wmca_
    complexed with gol

Details for d5me7d1

PDB Entry: 5me7 (more details), 2.2 Å

PDB Description: crystal structure of eif4e from c. melo
PDB Compounds: (D:) Eukaryotic transcription initiation factor 4E

SCOPe Domain Sequences for d5me7d1:

Sequence, based on SEQRES records: (download)

>d5me7d1 d.86.1.0 (D:53-235) automated matches {Cucumis melo [TaxId: 3656]}
aslvhqphplehswtfwfdnpsakskqatwgasirpiytfstveefwsvynnihhpskla
mradlycfkhkiepkwedpvcanggkwtvnfprgksdngwlytllamigeqfdcgdeicg
avvnvrsgqdkisiwtknasneaaqasigkqwkefldynesigfifhddakkfdrhaknk
ymv

Sequence, based on observed residues (ATOM records): (download)

>d5me7d1 d.86.1.0 (D:53-235) automated matches {Cucumis melo [TaxId: 3656]}
aslvhqphplehswtfwfdnpirpiytfstveefwsvynnihhpsklamradlycfkhki
epkwedpvcanggkwtvnfprgksdngwlytllamigeqfdcgdeicgavvnvrsgqdki
siwtknasneaaqasigkqwkefldynesigfifhddakkfdrhaknkymv

SCOPe Domain Coordinates for d5me7d1:

Click to download the PDB-style file with coordinates for d5me7d1.
(The format of our PDB-style files is described here.)

Timeline for d5me7d1: