Lineage for d1pcaa2 (1pca A:1-308)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2497307Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2497308Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)
  6. 2497309Protein Carboxypeptidase A [53189] (4 species)
  7. 2497373Species Pig (Sus scrofa) [TaxId:9823] [53191] (1 PDB entry)
  8. 2497374Domain d1pcaa2: 1pca A:1-308 [33822]
    Other proteins in same PDB: d1pcaa1
    zymogen
    complexed with cit, val, zn

Details for d1pcaa2

PDB Entry: 1pca (more details), 2 Å

PDB Description: three dimensional structure of porcine pancreatic procarboxypeptidase a. a comparison of the a and b zymogens and their determinants for inhibition and activation
PDB Compounds: (A:) procarboxypeptidase a pcpa

SCOPe Domain Sequences for d1pcaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pcaa2 c.56.5.1 (A:1-308) Carboxypeptidase A {Pig (Sus scrofa) [TaxId: 9823]}
arttstfnyatyhtleeiydfmdilvaehpalvsklqigrsyegrpiyvlkfstggsnrp
aiwidsgihsrewitqasgvwfakkitenygqnssftaildsmdifleivtnpngfafth
sdnrlwrktrskasgslcvgsdsnrnwdagfggagassspcaetyhgkypnsevevksit
dfvknngnikafisihsysqlllypygyktqspadkselnqiaksavaalkslygtsyky
gsiitviyqasggvidwtynqgikysfsfelrdtgrrgfllpasqiiptaqetwlallti
mehtlnns

SCOPe Domain Coordinates for d1pcaa2:

Click to download the PDB-style file with coordinates for d1pcaa2.
(The format of our PDB-style files is described here.)

Timeline for d1pcaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pcaa1