SCOPe 2.07: Domain d5ndcb1: 5ndc B:2-40

Lineage for d5ndcb1 (5ndc B:2-40)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)

6. Protein Bacterial ba3 type cytochrome c oxidase subunit II [81460] (1 species)

7. Species Thermus thermophilus [TaxId:274] [81459] (23 PDB entries)
   the "missing" first helix is complemented by the ba3 subunit IIa

8. Domain d5ndcb1: 5ndc B:2-40 [338200]
   Other proteins in same PDB: d5ndca_, d5ndcb2, d5ndcc_
   automated match to d1ehkb2
   complexed with cu, cua, has, hem, olc

Details for d5ndcb1

PDB Entry: 5ndc, 2.3 Å

PDB Description: structure of ba3-type cytochrome c oxidase from thermus thermophilus by serial femtosecond crystallography

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d5ndcb1:

Sequence; same for both SEQRES and ATOM records:

>d5ndcb1 f.17.2.1 (B:2-40) Bacterial ba3 type cytochrome c oxidase subunit II {Thermus thermophilus [TaxId: 274]}
vdehkahkailayekgwlafslamlfvfialiaytlath

Timeline for d5ndcb1:

• d5ndcb1 first appeared in SCOPe 2.06
  
• d5ndcb1 appears in the current release, SCOPe 2.08