Lineage for d5gtaa_ (5gta A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2161445Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2161446Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2161447Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
  6. 2161682Protein automated matches [190296] (11 species)
    not a true protein
  7. 2161733Species Salmonella enterica [TaxId:90370] [338170] (1 PDB entry)
  8. 2161734Domain d5gtaa_: 5gta A: [338171]
    automated match to d3t95a_
    complexed with pav

Details for d5gtaa_

PDB Entry: 5gta (more details), 3 Å

PDB Description: 3d crystal structure of lsrb bound to furanosyl diester (r)-thmf, from salmonella typhi
PDB Compounds: (A:) Autoinducer 2-binding protein lsrB

SCOPe Domain Sequences for d5gtaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gtaa_ c.93.1.1 (A:) automated matches {Salmonella enterica [TaxId: 90370]}
aeriafipklvgvgfftsggngaqeagkalgidvtydgptepsvsgqvqlvnnfvnqgyd
aiivsavspdglcpalkramqrgvkiltwdsdtkpecrsyyinqgtpkqlgsmlvemaah
qvdkekakvaffyssptvtdqnqwvkeakakisqehpgweivttqfgyndatkslqtaeg
iikaypdldaiiapdanalpaaaqaaenlkrnnlaivgfstpnvmrpyvqrgtvkefglw
dvvqqgkisvyvanallknmpmnvgdsldipgigkvtvspnseqgyhyeakgngivllpe
rvifnkdnidkydf

SCOPe Domain Coordinates for d5gtaa_:

Click to download the PDB-style file with coordinates for d5gtaa_.
(The format of our PDB-style files is described here.)

Timeline for d5gtaa_: