Lineage for d8cpa__ (8cpa -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25480Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 25553Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) (S)
  5. 25554Family c.56.5.1: Pancreatic carboxypeptidases [53188] (3 proteins)
  6. 25555Protein Carboxypeptidase A [53189] (3 species)
  7. 25556Species Cow (Bos taurus) [TaxId:9913] [53190] (17 PDB entries)
  8. 25572Domain d8cpa__: 8cpa - [33817]

Details for d8cpa__

PDB Entry: 8cpa (more details), 2 Å

PDB Description: comparison of the structures of three carboxypeptidase a-phosphonate complexes determined by x-ray crystallography

SCOP Domain Sequences for d8cpa__:

Sequence; same for both SEQRES and ATOM records: (download)

>d8cpa__ c.56.5.1 (-) Carboxypeptidase A {Cow (Bos taurus)}
arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtvnn

SCOP Domain Coordinates for d8cpa__:

Click to download the PDB-style file with coordinates for d8cpa__.
(The format of our PDB-style files is described here.)

Timeline for d8cpa__: