Lineage for d1cpxa_ (1cpx A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2497307Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2497308Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)
  6. 2497309Protein Carboxypeptidase A [53189] (4 species)
  7. 2497312Species Cow (Bos taurus) [TaxId:9913] [53190] (34 PDB entries)
  8. 2497362Domain d1cpxa_: 1cpx A: [33814]
    truncated beta form with two zinc ions in the active site
    complexed with oh, zn

Details for d1cpxa_

PDB Entry: 1cpx (more details), 2 Å

PDB Description: beta form of carboxypeptidase a (residues 3-307) from bovine pancreas in an orthorhombic crystal form with two zinc ions in the active site.
PDB Compounds: (A:) protein (carboxypeptidase a)

SCOPe Domain Sequences for d1cpxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cpxa_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]}
stntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrpai
widlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafthsq
nrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksivdf
vkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsykygs
iittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvltime
htvnn

SCOPe Domain Coordinates for d1cpxa_:

Click to download the PDB-style file with coordinates for d1cpxa_.
(The format of our PDB-style files is described here.)

Timeline for d1cpxa_: