SCOPe 2.08: Domain d5x8ll2: 5x8l L:107-211

Lineage for d5x8ll2 (5x8l L:107-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5x8ll2: 5x8l L:107-211 [338113]
   Other proteins in same PDB: d5x8la_, d5x8lb_, d5x8lc_, d5x8ld_, d5x8le_, d5x8lf_, d5x8lg_, d5x8lh_, d5x8lj_, d5x8lk1, d5x8ll1, d5x8lm1, d5x8ln1, d5x8lo1, d5x8ls_
   automated match to d1dn0a2

Details for d5x8ll2

PDB Entry: 5x8l, 3.1 Å

PDB Description: pd-l1 in complex with atezolizumab

PDB Compounds: (L:) atezolizumab light chain

SCOPe Domain Sequences for d5x8ll2:

Sequence, based on SEQRES records:

>d5x8ll2 b.1.1.2 (L:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Sequence, based on observed residues (ATOM records):

>d5x8ll2 b.1.1.2 (L:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwnsqesvteqdskdstysl
sstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d5x8ll2:

• d5x8ll2 first appeared in SCOPe 2.06
  
• d5x8ll2 appears in SCOPe 2.07