Lineage for d5x8ma_ (5x8m A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (26 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1264 PDB entries)
  8. 2357093Domain d5x8ma_: 5x8m A: [338095]
    Other proteins in same PDB: d5x8mc1, d5x8mc2
    automated match to d3bova_

Details for d5x8ma_

PDB Entry: 5x8m (more details), 2.66 Å

PDB Description: pd-l1 in complex with durvalumab
PDB Compounds: (A:) Programmed cell death 1 ligand 1

SCOPe Domain Sequences for d5x8ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x8ma_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aftvtvpkdlyvveygsnmtieckfpvekeldlaalivywemedkniiqfvhgeedlkvq
hssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnap

SCOPe Domain Coordinates for d5x8ma_:

Click to download the PDB-style file with coordinates for d5x8ma_.
(The format of our PDB-style files is described here.)

Timeline for d5x8ma_: