Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.39: DLC [54647] (1 superfamily) core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342 |
Superfamily d.39.1: DLC [54648] (1 family) automatically mapped to Pfam PF01221 |
Family d.39.1.1: DLC [54649] (3 proteins) 8 kDa dynein light chain, DLC8 |
Protein automated matches [190350] (4 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [188146] (1 PDB entry) |
Domain d5wofa1: 5wof A:1-83 [338069] Other proteins in same PDB: d5wofa2, d5wofb2, d5wofc2 automated match to d1f95a_ |
PDB Entry: 5wof (more details), 1.65 Å
SCOPe Domain Sequences for d5wofa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wofa1 d.39.1.1 (A:1-83) automated matches {Plasmodium falciparum [TaxId: 36329]} vvknvdmteemqidaidcanqalqkynvekdiaahikkefdrkydptwhcvvgrnfgsyv thetknfiyfyigqvaillfksg
Timeline for d5wofa1:
View in 3D Domains from other chains: (mouse over for more information) d5wofb1, d5wofb2, d5wofc1, d5wofc2 |