Lineage for d5x8lb_ (5x8l B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2759265Domain d5x8lb_: 5x8l B: [338052]
    Other proteins in same PDB: d5x8lf_, d5x8lg_, d5x8lh_, d5x8lj_, d5x8lk2, d5x8ll2, d5x8lm2, d5x8ln2, d5x8lo2, d5x8ls_
    automated match to d3bova_

Details for d5x8lb_

PDB Entry: 5x8l (more details), 3.1 Å

PDB Description: pd-l1 in complex with atezolizumab
PDB Compounds: (B:) Programmed cell death 1 ligand 1

SCOPe Domain Sequences for d5x8lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x8lb_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aftvtvpkdlyvveygsnmtieckfpvekeldlaalivywemedkniiqfvhgeedlkvq
hssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnap

SCOPe Domain Coordinates for d5x8lb_:

Click to download the PDB-style file with coordinates for d5x8lb_.
(The format of our PDB-style files is described here.)

Timeline for d5x8lb_: