Lineage for d5lnxa2 (5lnx A:227-376)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708478Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2708479Protein automated matches [226935] (30 species)
    not a true protein
  7. 2708495Species Bacillus subtilis [TaxId:224308] [337850] (1 PDB entry)
  8. 2708496Domain d5lnxa2: 5lnx A:227-376 [338026]
    Other proteins in same PDB: d5lnxa1, d5lnxb1, d5lnxc1, d5lnxd1, d5lnxe1, d5lnxf1, d5lnxg1, d5lnxh1
    automated match to d3mdea1
    complexed with fad, gol

Details for d5lnxa2

PDB Entry: 5lnx (more details), 2.6 Å

PDB Description: crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis.
PDB Compounds: (A:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d5lnxa2:

Sequence, based on SEQRES records: (download)

>d5lnxa2 a.29.3.0 (A:227-376) automated matches {Bacillus subtilis [TaxId: 224308]}
gdgfhiamanlnvgrigiaaqalgiaeaalehavdyakqrvqfgrpiaanqgisfkladm
atraeaarhlvyhaadlhnrglncgkeasmakqfasdaavkaaldavqiyggygymkdyp
verllrdakvtqiyegtneiqrliiskyllg

Sequence, based on observed residues (ATOM records): (download)

>d5lnxa2 a.29.3.0 (A:227-376) automated matches {Bacillus subtilis [TaxId: 224308]}
gdgfhiamanlnvgrigiaaqalgiaeaalehavdyakqrvqfgrpiaanqgisfkladm
atraeaarhlvyhaadlhnglncgkeasmakqfasdaavkalvqiyggygymkdypverl
lrdakvtqiyegtneiqrliiskyllg

SCOPe Domain Coordinates for d5lnxa2:

Click to download the PDB-style file with coordinates for d5lnxa2.
(The format of our PDB-style files is described here.)

Timeline for d5lnxa2: