Lineage for d5w1ua_ (5w1u A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2152836Species Culex quinquefasciatus [TaxId:7176] [337959] (1 PDB entry)
  8. 2152837Domain d5w1ua_: 5w1u A: [338007]
    automated match to d1qona_
    complexed with epe, mli

Details for d5w1ua_

PDB Entry: 5w1u (more details), 2.5 Å

PDB Description: culex quinquefasciatus carboxylesterase b2
PDB Compounds: (A:) Carboxylic ester hydrolase

SCOPe Domain Sequences for d5w1ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w1ua_ c.69.1.0 (A:) automated matches {Culex quinquefasciatus [TaxId: 7176]}
sltvqtkygpvrgkrsvsllgqeyvsfqgipyarapegelrfkapvppqnwtetldcsqq
cepcyhfdrrlqkivgcedslkinvfakeinpskplpvmlyiygggftegtsgtelygpd
flvqkdivlvsfnyrigalgflccqseqdgvpgnaglkdqnlairwvleniaafggdpkr
vtlvghsagaasvqyhlisdaskdlfqraivmsgstynswsltrqrnwveklakaigwdg
qggesgalrflkaakpedivanqeklltdqdmqddiftpfgptvepylteqcmipkepfe
martawgdkidimiggtseegllllqkiklqpellshphlflgnvppnlkismekriefa
aklkqryypdsspsmennlgyvhmmsdrvfwhglhrtilaraarsrartfvyricldsef
ynhyrimmidpklrgtahadelsylfsnftqqvpgketfeyrglqtlvdvftafvingdp
ncgmtaksgvvfepnaqtkptfkclniandgvafvdypdadrldmwdamyvndelf

SCOPe Domain Coordinates for d5w1ua_:

Click to download the PDB-style file with coordinates for d5w1ua_.
(The format of our PDB-style files is described here.)

Timeline for d5w1ua_: