Lineage for d5nj4h2 (5nj4 H:37-258)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061299Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2061300Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2061301Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 2061302Protein Photosynthetic reaction centre [50348] (4 species)
  7. 2061398Species Rhodopseudomonas viridis [TaxId:1079] [50349] (19 PDB entries)
  8. 2061415Domain d5nj4h2: 5nj4 H:37-258 [337974]
    Other proteins in same PDB: d5nj4c_, d5nj4h1, d5nj4l_, d5nj4m_
    automated match to d6prch1
    complexed with bcb, bpb, dga, fe2, hec, hto, lda, mq7, ns5, so4

Details for d5nj4h2

PDB Entry: 5nj4 (more details), 2.4 Å

PDB Description: from macrocrystals to microcrystals: a strategy for membrane protein serial crystallography
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d5nj4h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nj4h2 b.41.1.1 (H:37-258) Photosynthetic reaction centre {Rhodopseudomonas viridis [TaxId: 1079]}
rregyplveplglvklapedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgf
egaplqptgnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglp
vvaadgveagtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilse
qfanvprlqsrdqitlreedkvsayyaggllyatperaesll

SCOPe Domain Coordinates for d5nj4h2:

Click to download the PDB-style file with coordinates for d5nj4h2.
(The format of our PDB-style files is described here.)

Timeline for d5nj4h2: