Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
Protein automated matches [190081] (33 species) not a true protein |
Species Enterobacter lignolyticus [TaxId:1334193] [337933] (1 PDB entry) |
Domain d5vj0b_: 5vj0 B: [337934] Other proteins in same PDB: d5vj0d2 automated match to d2iiza_ complexed with hem |
PDB Entry: 5vj0 (more details), 1.93 Å
SCOPe Domain Sequences for d5vj0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vj0b_ d.58.4.0 (B:) automated matches {Enterobacter lignolyticus [TaxId: 1334193]} sqvqsgilpehcraaiwieanvkgdvnalrecskvfadklagfeaqfpdahlgavvafgh dtwralsggvgaeelkdftpygkglapatqydvlihilslrhdvnfsvaqaamaafgdav evkeeihgfrwveerdlsgfvdgtenpageetrrevavikdgvdaggsyvfvqrwehnlk qlnrmsvhdqemmigrtkvaneeidgderpetshltrvdlkengkglkivrqslpygtas gthglyfcaycarlynieqqllsmfgdtdgkrdamlrftkpvtggyyfapsldkllal
Timeline for d5vj0b_:
View in 3D Domains from other chains: (mouse over for more information) d5vj0a_, d5vj0c_, d5vj0d1, d5vj0d2 |