SCOPe 2.08: Domain d5u51d2: 5u51 D:80-194

Lineage for d5u51d2 (5u51 D:80-194)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Francisella tularensis [TaxId:263] [337921] (2 PDB entries)

8. Domain d5u51d2: 5u51 D:80-194 [337932]
   Other proteins in same PDB: d5u51c1, d5u51c3, d5u51d1, d5u51d3
   automated match to d1yy7b2
   complexed with 1pe, g4p, gol, mg

Details for d5u51d2

PDB Entry: 5u51, 2.8 Å

PDB Description: structure of francisella tularensis heterodimeric sspa (mgla-sspa) in complex with ppgpp

PDB Compounds: (D:) stringent starvation protein A

SCOPe Domain Sequences for d5u51d2:

Sequence; same for both SEQRES and ATOM records:

>d5u51d2 a.45.1.0 (D:80-194) automated matches {Francisella tularensis [TaxId: 263]}
llpnvvnerikirlsldkidnewypvldqirkhrsdqkmlesmfkdlkesllamekaftg
seffissgftladcyiaaliicleaegfiiddeygaiyeykkrlfardsvkkani

Timeline for d5u51d2:

• d5u51d2 first appeared in SCOPe 2.06
  
• d5u51d2 appears in SCOPe 2.07