Lineage for d2pth__ (2pth -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) Superfamily c.56.3: Peptidyl-tRNA hydrolase [53178] (1 family) 
Family c.56.3.1: Peptidyl-tRNA hydrolase [53179] (1 protein) Protein Peptidyl-tRNA hydrolase [53180] (1 species) Species Escherichia coli [TaxId:562] [53181] (1 PDB entry) 
Domain d2pth__: 2pth - [33793]
Details for d2pth__
PDB Entry: 2pth (more details), 1.2 Å
PDB Description: peptidyl-trna hydrolase from escherichia coli
SCOP Domain Sequences for d2pth__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pth__ c.56.3.1 (-) Peptidyl-tRNA hydrolase {Escherichia coli}
tiklivglanpgaeyaatrhnagawfvdllaerlraplreeakffgytsrvtlggedvrl
lvpttfmnlsgkavaamasffrinpdeilvahdeldlppgvakfklggghgghnglkdii
sklgnnpnfhrlrigighpgdknkvvgfvlgkppvseqklideaideaarctemwftdgl
tkatnrlhafkaq
SCOP Domain Coordinates for d2pth__:
Click to download the PDB-style file with coordinates for d2pth__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2pth__:
- d2pth__ appears in SCOP 1.57
- d2pth__ appears in the current release, SCOPe 2.08, called d2ptha_
View in 3D