Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Francisella tularensis [TaxId:263] [337919] (2 PDB entries) |
Domain d5u56c1: 5u56 C:4-79 [337920] Other proteins in same PDB: d5u56c2, d5u56c3, d5u56d2, d5u56d3 automated match to d1yy7b1 complexed with 1pe, gol, pro |
PDB Entry: 5u56 (more details), 2.65 Å
SCOPe Domain Sequences for d5u56c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u56c1 c.47.1.0 (C:4-79) automated matches {Francisella tularensis [TaxId: 263]} vtlyttkycpyslrarialaekkmstdiveagdlepamikkitpngvfpvlmekdysinn rkalliyiderfpaps
Timeline for d5u56c1: