SCOPe 2.06: Domain d5nj4m_: 5nj4 M:

Lineage for d5nj4m_ (5nj4 M:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (4 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81478] (14 PDB entries)

8. Domain d5nj4m_: 5nj4 M: [337913]
   Other proteins in same PDB: d5nj4c_, d5nj4h1, d5nj4h2, d5nj4l_
   automated match to d6prcm_
   complexed with bcb, bpb, dga, fe2, hec, hto, lda, mq7, ns5, so4

Details for d5nj4m_

PDB Entry: 5nj4, 2.4 Å

PDB Description: from macrocrystals to microcrystals: a strategy for membrane protein serial crystallography

PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d5nj4m_:

Sequence; same for both SEQRES and ATOM records:

>d5nj4m_ f.26.1.1 (M:) M (medium) subunit {Rhodopseudomonas viridis [TaxId: 1079]}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

Timeline for d5nj4m_:

• d5nj4m_ is new in SCOPe 2.06-stable
  
• d5nj4m_ appears in SCOPe 2.07
  
• d5nj4m_ appears in the current release, SCOPe 2.08