SCOPe 2.08: Domain d5n69g_: 5n69 G:

Lineage for d5n69g_ (5n69 G:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (36 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [311228] (3 PDB entries)

8. Domain d5n69g_: 5n69 G: [337872]
   automated match to d3i5fc_
   complexed with 2ow, adp, gol, mg, tce, vo4

Details for d5n69g_

PDB Entry: 5n69, 2.45 Å

PDB Description: cardiac muscle myosin s1 fragment in the pre-powerstroke state co- crystallized with the activator omecamtiv mecarbil

PDB Compounds: (G:) Myosin light chain 3

SCOPe Domain Sequences for d5n69g_:

Sequence, based on SEQRES records:

>d5n69g_ a.39.1.0 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
fdpskikieftpeqieefkeaftlfdrtpkcemkitygqcgdvlralgqnptqaevlrvl
gkpkqeelnskmmdfdtflpmlqhisknkdtgtyedfveglrvfdkegngtvmgaelrhv
latlgekltedeveklmagqedsngcinyeafvkhimag

Sequence, based on observed residues (ATOM records):

>d5n69g_ a.39.1.0 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
fdpskikieftpeqieefkeaftlfdrtpkcemkitygqcgdvlralgqnptqaevlrvl
gkpkqeelnskmmdfdtflpmlqhisknkdtgtyedfveglrvfdkegngtvmgaelrhv
latlgekltedeveklmaedngcinyeafvkhimag

Timeline for d5n69g_:

• d5n69g_ first appeared in SCOPe 2.06
  
• d5n69g_ appears in SCOPe 2.07