Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
Protein automated matches [226934] (29 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [337846] (1 PDB entry) |
Domain d5lnxc1: 5lnx C:8-226 [337869] Other proteins in same PDB: d5lnxa2, d5lnxb2, d5lnxc2, d5lnxd2, d5lnxe2, d5lnxf2, d5lnxg2, d5lnxh2 automated match to d3mdea2 complexed with fad, gol |
PDB Entry: 5lnx (more details), 2.6 Å
SCOPe Domain Sequences for d5lnxc1:
Sequence, based on SEQRES records: (download)
>d5lnxc1 e.6.1.0 (C:8-226) automated matches {Bacillus subtilis [TaxId: 224308]} vmmrkmvrdfarkeiapaaeimektdefpfqlikkmgkhglmgipvpeqyggagadvvsy ilaiheisrisaavgvilsvhtsvgtnpilyfgneeqkmkyipnlasgdhlgafalteph sgsdagslrttaikkngkyllngskifitnggaadiyitfaltapdqgrhgisafivekn tpgftvgkkerklglygsnttelifdnaevpeanllgke
>d5lnxc1 e.6.1.0 (C:8-226) automated matches {Bacillus subtilis [TaxId: 224308]} vmmrkmvrdfarkeiapaaeimektdefpfqlikkmgkhglmgipvpeqyggagadvvsy ilaiheisrisaavgvilsvhtsvgtnpilyfgeeqkmkyipnlasgdhlgafaltephs gsdagslrttaikkngkyllngskifitnggaadiyitfaltapdqgrhgisafiveknt pgftvgkkerklglygsnttelifdnaevpanllgke
Timeline for d5lnxc1: