Lineage for d5lnxc1 (5lnx C:8-226)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3015483Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 3015484Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 3015629Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 3015630Protein automated matches [226934] (29 species)
    not a true protein
  7. 3015646Species Bacillus subtilis [TaxId:224308] [337846] (1 PDB entry)
  8. 3015649Domain d5lnxc1: 5lnx C:8-226 [337869]
    Other proteins in same PDB: d5lnxa2, d5lnxb2, d5lnxc2, d5lnxd2, d5lnxe2, d5lnxf2, d5lnxg2, d5lnxh2
    automated match to d3mdea2
    complexed with fad, gol

Details for d5lnxc1

PDB Entry: 5lnx (more details), 2.6 Å

PDB Description: crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis.
PDB Compounds: (C:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d5lnxc1:

Sequence, based on SEQRES records: (download)

>d5lnxc1 e.6.1.0 (C:8-226) automated matches {Bacillus subtilis [TaxId: 224308]}
vmmrkmvrdfarkeiapaaeimektdefpfqlikkmgkhglmgipvpeqyggagadvvsy
ilaiheisrisaavgvilsvhtsvgtnpilyfgneeqkmkyipnlasgdhlgafalteph
sgsdagslrttaikkngkyllngskifitnggaadiyitfaltapdqgrhgisafivekn
tpgftvgkkerklglygsnttelifdnaevpeanllgke

Sequence, based on observed residues (ATOM records): (download)

>d5lnxc1 e.6.1.0 (C:8-226) automated matches {Bacillus subtilis [TaxId: 224308]}
vmmrkmvrdfarkeiapaaeimektdefpfqlikkmgkhglmgipvpeqyggagadvvsy
ilaiheisrisaavgvilsvhtsvgtnpilyfgeeqkmkyipnlasgdhlgafaltephs
gsdagslrttaikkngkyllngskifitnggaadiyitfaltapdqgrhgisafiveknt
pgftvgkkerklglygsnttelifdnaevpanllgke

SCOPe Domain Coordinates for d5lnxc1:

Click to download the PDB-style file with coordinates for d5lnxc1.
(The format of our PDB-style files is described here.)

Timeline for d5lnxc1: