Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.1: Bromodomain [47371] (6 proteins) |
Protein automated matches [190366] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187201] (67 PDB entries) |
Domain d5lpmb1: 5lpm B:1048-1161 [337862] Other proteins in same PDB: d5lpma2, d5lpmb2 automated match to d3i3je_ complexed with 71y, act |
PDB Entry: 5lpm (more details), 1.5 Å
SCOPe Domain Sequences for d5lpmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lpmb1 a.29.2.1 (B:1048-1161) automated matches {Human (Homo sapiens) [TaxId: 9606]} ifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdlstikrkld tgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqslg
Timeline for d5lpmb1: