Lineage for d5lpmb1 (5lpm B:1048-1161)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706695Family a.29.2.1: Bromodomain [47371] (6 proteins)
  6. 2706816Protein automated matches [190366] (2 species)
    not a true protein
  7. 2706817Species Human (Homo sapiens) [TaxId:9606] [187201] (46 PDB entries)
  8. 2706831Domain d5lpmb1: 5lpm B:1048-1161 [337862]
    Other proteins in same PDB: d5lpma2, d5lpmb2
    automated match to d3i3je_
    complexed with 71y, act

Details for d5lpmb1

PDB Entry: 5lpm (more details), 1.5 Å

PDB Description: crystal structure of the bromodomain of human ep300 bound to the inhibitor xdm3d
PDB Compounds: (B:) Histone acetyltransferase p300

SCOPe Domain Sequences for d5lpmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lpmb1 a.29.2.1 (B:1048-1161) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdlstikrkld
tgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqslg

SCOPe Domain Coordinates for d5lpmb1:

Click to download the PDB-style file with coordinates for d5lpmb1.
(The format of our PDB-style files is described here.)

Timeline for d5lpmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5lpmb2