Lineage for d5lpkc_ (5lpk C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2319938Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2319939Family a.29.2.1: Bromodomain [47371] (6 proteins)
  6. 2320024Protein automated matches [190366] (2 species)
    not a true protein
  7. 2320025Species Human (Homo sapiens) [TaxId:9606] [187201] (67 PDB entries)
  8. 2320141Domain d5lpkc_: 5lpk C: [337861]
    automated match to d4nyxa_
    complexed with edo, pg4, so4, xdm

Details for d5lpkc_

PDB Entry: 5lpk (more details), 2.1 Å

PDB Description: crystal structure of the bromodomain of human ep300 bound to the inhibitor xdm1
PDB Compounds: (C:) Histone acetyltransferase p300

SCOPe Domain Sequences for d5lpkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lpkc_ a.29.2.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdlstikrkld
tgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqslg

SCOPe Domain Coordinates for d5lpkc_:

Click to download the PDB-style file with coordinates for d5lpkc_.
(The format of our PDB-style files is described here.)

Timeline for d5lpkc_: