Lineage for d5llnb_ (5lln B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2077896Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2077897Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2077898Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 2078755Protein automated matches [190681] (2 species)
    not a true protein
  7. 2078765Species Human (Homo sapiens) [TaxId:9606] [187805] (29 PDB entries)
  8. 2078793Domain d5llnb_: 5lln B: [337835]
    automated match to d3d0na_
    complexed with 3tv, cit, zn

Details for d5llnb_

PDB Entry: 5lln (more details), 1.6 Å

PDB Description: crystal structure of human carbonic anhydrase isozyme xiii with 2,3,5, 6-tetrafluoro-4-(propylthio)benzenesulfonamide
PDB Compounds: (B:) Carbonic anhydrase 13

SCOPe Domain Sequences for d5llnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5llnb_ b.74.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
swgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssakiisnsg
hsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaaelhvvhw
nsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftnfdlls
llppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaaaflvs
nhrppqplkgrkvrasfh

SCOPe Domain Coordinates for d5llnb_:

Click to download the PDB-style file with coordinates for d5llnb_.
(The format of our PDB-style files is described here.)

Timeline for d5llnb_: