SCOPe 2.08: Domain d5llnb_: 5lln B:

Lineage for d5llnb_ (5lln B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein automated matches [190681] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187805] (57 PDB entries)

8. Domain d5llnb_: 5lln B: [337835]
   automated match to d3d0na_
   complexed with 3tv, cit, zn

Details for d5llnb_

PDB Entry: 5lln, 1.6 Å

PDB Description: crystal structure of human carbonic anhydrase isozyme xiii with 2,3,5, 6-tetrafluoro-4-(propylthio)benzenesulfonamide

PDB Compounds: (B:) Carbonic anhydrase 13

SCOPe Domain Sequences for d5llnb_:

Sequence; same for both SEQRES and ATOM records:

>d5llnb_ b.74.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
swgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssakiisnsg
hsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaaelhvvhw
nsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftnfdlls
llppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaaaflvs
nhrppqplkgrkvrasfh

Timeline for d5llnb_:

• d5llnb_ first appeared in SCOPe 2.06
  
• d5llnb_ appears in SCOPe 2.07