Lineage for d5w97a_ (5w97 A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632295Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 2632296Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 2632297Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 2632350Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species)
  7. 2632351Species Cow (Bos taurus) [TaxId:9913] [81432] (35 PDB entries)
  8. 2632408Domain d5w97a_: 5w97 A: [337820]
    Other proteins in same PDB: d5w97b1, d5w97b2, d5w97c_, d5w97d_, d5w97e_, d5w97f_, d5w97g_, d5w97h_, d5w97i_, d5w97j_, d5w97k_, d5w97l_, d5w97m_
    automated match to d1v54a_
    complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d5w97a_

PDB Entry: 5w97 (more details), 2.3 Å

PDB Description: crystal structure of co-bound cytochrome c oxidase determined by serial femtosecond x-ray crystallography at room temperature
PDB Compounds: (A:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d5w97a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w97a_ f.24.1.1 (A:) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]}
mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
evltvdltttnlewlngcpppyhtfeeptyvnlk

SCOPe Domain Coordinates for d5w97a_:

Click to download the PDB-style file with coordinates for d5w97a_.
(The format of our PDB-style files is described here.)

Timeline for d5w97a_: