Class a: All alpha proteins [46456] (290 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) automatically mapped to Pfam PF02284 |
Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins) |
Protein Cytochrome c oxidase subunit E [48481] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [48482] (50 PDB entries) |
Domain d5waue_: 5wau E: [337816] Other proteins in same PDB: d5waua_, d5waub1, d5waub2, d5wauc_, d5waud_, d5wauf_, d5waug_, d5wauh_, d5waui_, d5wauj_, d5wauk_, d5waul_, d5waum_ automated match to d1v54e_ complexed with cdl, chd, cmo, cu, cua, dmu, fme, hea, mg, na, pek, pgv, psc, sac, tgl, zn |
PDB Entry: 5wau (more details), 1.95 Å
SCOPe Domain Sequences for d5waue_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5waue_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
Timeline for d5waue_: