Lineage for d5xhna_ (5xhn A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2700840Protein (Apo)ferritin [47246] (8 species)
  7. 2700841Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (21 PDB entries)
  8. 2700853Domain d5xhna_: 5xhn A: [337803]
    automated match to d4lqha_
    complexed with cl, mg; mutant

Details for d5xhna_

PDB Entry: 5xhn (more details), 1.63 Å

PDB Description: crystal structure of frog m-ferritin k104e mutant
PDB Compounds: (A:) Ferritin, middle subunit

SCOPe Domain Sequences for d5xhna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xhna_ a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]}
vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqleetvnqalldlhklatdk
vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkes

SCOPe Domain Coordinates for d5xhna_:

Click to download the PDB-style file with coordinates for d5xhna_.
(The format of our PDB-style files is described here.)

Timeline for d5xhna_: