Lineage for d5x1bp_ (5x1b P:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632473Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 2632474Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) (S)
    automatically mapped to Pfam PF00510
  5. 2632475Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 2632488Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)
  7. 2632489Species Cow (Bos taurus) [TaxId:9913] [81444] (52 PDB entries)
  8. 2632583Domain d5x1bp_: 5x1b P: [337801]
    Other proteins in same PDB: d5x1ba_, d5x1bb1, d5x1bb2, d5x1bd_, d5x1be_, d5x1bf_, d5x1bg_, d5x1bh_, d5x1bi_, d5x1bj_, d5x1bk_, d5x1bl_, d5x1bm_, d5x1bn_, d5x1bo1, d5x1bo2, d5x1bq_, d5x1br_, d5x1bs_, d5x1bt_, d5x1bu_, d5x1bv_, d5x1bw_, d5x1bx_, d5x1by_, d5x1bz_
    automated match to d2occc_
    complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5x1bp_

PDB Entry: 5x1b (more details), 2.4 Å

PDB Description: co bound cytochrome c oxidase at 20 nsec after pump laser irradiation to release co from o2 reduction center
PDB Compounds: (P:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d5x1bp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x1bp_ f.25.1.1 (P:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

SCOPe Domain Coordinates for d5x1bp_:

Click to download the PDB-style file with coordinates for d5x1bp_.
(The format of our PDB-style files is described here.)

Timeline for d5x1bp_: