Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) |
Protein Cytochrome c oxidase [49544] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [49545] (45 PDB entries) |
Domain d5x19b2: 5x19 B:91-227 [337800] Other proteins in same PDB: d5x19a_, d5x19b1, d5x19c_, d5x19d_, d5x19e_, d5x19f_, d5x19g_, d5x19h_, d5x19i_, d5x19j_, d5x19k_, d5x19l_, d5x19m_, d5x19n_, d5x19o1, d5x19p_, d5x19q_, d5x19r_, d5x19s_, d5x19t_, d5x19u_, d5x19v_, d5x19w_, d5x19x_, d5x19y_, d5x19z_ automated match to d1v54b1 complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5x19 (more details), 2.2 Å
SCOPe Domain Sequences for d5x19b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x19b2 b.6.1.2 (B:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]} nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv lelvplkyfekwsasml
Timeline for d5x19b2:
View in 3D Domains from other chains: (mouse over for more information) d5x19a_, d5x19c_, d5x19d_, d5x19e_, d5x19f_, d5x19g_, d5x19h_, d5x19i_, d5x19j_, d5x19k_, d5x19l_, d5x19m_, d5x19n_, d5x19o1, d5x19o2, d5x19p_, d5x19q_, d5x19r_, d5x19s_, d5x19t_, d5x19u_, d5x19v_, d5x19w_, d5x19x_, d5x19y_, d5x19z_ |