SCOPe 2.08: Domain d5xtgb_: 5xtg B:

Lineage for d5xtgb_ (5xtg B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Pseudomonas sp. [TaxId:1123041] [337779] (2 PDB entries)

8. Domain d5xtgb_: 5xtg B: [337781]
   automated match to d3i3og_
   complexed with bpy, cit, nad

Details for d5xtgb_

PDB Entry: 5xtg, 2.32 Å

PDB Description: crystal structure of the cis-dihydrodiol naphthalene dehydrogenase nahb from pseudomonas sp. mc1 in the presence of nad+ and 2,3- dihydroxybiphenyl

PDB Compounds: (B:) 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase

SCOPe Domain Sequences for d5xtgb_:

Sequence, based on SEQRES records:

>d5xtgb_ c.2.1.0 (B:) automated matches {Pseudomonas sp. [TaxId: 1123041]}
nqqvvsitgagsgiglelvrsfklagycvsalvrneeqeallcnefkdaleivvgdvrdh
atneklikqtidrfghldcfianagiwdymlnieepwekisssfdeifdinvksyfsgis
aalpelkktngsvvmtasvsshavggggscyiaskhavlgmvkalayelapeirvnavsp
ggtvtslcgpasagfdkmhmkdmpgiddmikgltplgfaakpedvvapylllasrkqgkf
itgtvisidggmalgrk

Sequence, based on observed residues (ATOM records):

>d5xtgb_ c.2.1.0 (B:) automated matches {Pseudomonas sp. [TaxId: 1123041]}
nqqvvsitgagsgiglelvrsfklagycvsalvrneeqeallcnefkdaleivvgdvrdh
atneklikqtidrfghldcfianagiwdymlnieepwekisssfdeifdinvksyfsgis
aalpelkktngsvvmtasvsshavggggscyiaskhavlgmvkalayelapeirvnavsp
ggtvtskgltplgfaakpedvvapylllasrkqgkfitgtvisidggmalgrk

Timeline for d5xtgb_:

• d5xtgb_ first appeared in SCOPe 2.06
  
• d5xtgb_ appears in SCOPe 2.07