SCOPe 2.06: Domain d5xeca_: 5xec A:

Lineage for d5xeca_ (5xec A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein automated matches [190113] (17 species)
   not a true protein

7. Species Hydrogenobacter thermophilus [TaxId:608538] [337765] (2 PDB entries)

8. Domain d5xeca_: 5xec A: [337768]
   automated match to d1dvva_
   complexed with hec

Details for d5xeca_

PDB Entry: 5xec, 1.1 Å

PDB Description: heterodimer constructed from pa cyt c551-ht cyt c552 and ht cyt c552- pa cyt c551 chimeric proteins

PDB Compounds: (A:) Cytochrome c-551,Cytochrome c-552

SCOPe Domain Sequences for d5xeca_:

Sequence; same for both SEQRES and ATOM records:

>d5xeca_ a.3.1.1 (A:) automated matches {Hydrogenobacter thermophilus [TaxId: 608538]}
edpevlfknkgcvachaidtkkvgpayadvakkyagrkdavdylagkikkggsgvwgsvp
mppqnvtdaeakqlaqwilsik

Timeline for d5xeca_:

• d5xeca_ is new in SCOPe 2.06-stable
  
• d5xeca_ appears in SCOPe 2.07
  
• d5xeca_ appears in the current release, SCOPe 2.08