SCOPe 2.07: Domain d5x1fb1: 5x1f B:1-90

Lineage for d5x1fb1 (5x1f B:1-90)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)

6. Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81454] (45 PDB entries)

8. Domain d5x1fb1: 5x1f B:1-90 [337762]
   Other proteins in same PDB: d5x1fa_, d5x1fb2, d5x1fc_, d5x1fd_, d5x1fe_, d5x1ff_, d5x1fg_, d5x1fh_, d5x1fi_, d5x1fj_, d5x1fk_, d5x1fl_, d5x1fm_, d5x1fn_, d5x1fo2, d5x1fp_, d5x1fq_, d5x1fr_, d5x1fs_, d5x1ft_, d5x1fu_, d5x1fv_, d5x1fw_, d5x1fx_, d5x1fy_, d5x1fz_
   automated match to d1v54b2
   complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5x1fb1

PDB Entry: 5x1f, 2.2 Å

PDB Description: co bound cytochrome c oxidase without pump laser irradiation at 278k

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d5x1fb1:

Sequence; same for both SEQRES and ATOM records:

>d5x1fb1 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

Timeline for d5x1fb1:

• d5x1fb1 first appeared in SCOPe 2.06
  
• d5x1fb1 appears in the current release, SCOPe 2.08