| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) ![]() |
| Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
| Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [81432] (35 PDB entries) |
| Domain d5x1bn_: 5x1b N: [337761] Other proteins in same PDB: d5x1bb1, d5x1bb2, d5x1bc_, d5x1bd_, d5x1be_, d5x1bf_, d5x1bg_, d5x1bh_, d5x1bi_, d5x1bj_, d5x1bk_, d5x1bl_, d5x1bm_, d5x1bo1, d5x1bo2, d5x1bp_, d5x1bq_, d5x1br_, d5x1bs_, d5x1bt_, d5x1bu_, d5x1bv_, d5x1bw_, d5x1bx_, d5x1by_, d5x1bz_ automated match to d1v54a_ complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5x1b (more details), 2.4 Å
SCOPe Domain Sequences for d5x1bn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x1bn_ f.24.1.1 (N:) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]}
mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
evltvdltttnlewlngcpppyhtfeeptyvnlk
Timeline for d5x1bn_:
View in 3DDomains from other chains: (mouse over for more information) d5x1ba_, d5x1bb1, d5x1bb2, d5x1bc_, d5x1bd_, d5x1be_, d5x1bf_, d5x1bg_, d5x1bh_, d5x1bi_, d5x1bj_, d5x1bk_, d5x1bl_, d5x1bm_, d5x1bo1, d5x1bo2, d5x1bp_, d5x1bq_, d5x1br_, d5x1bs_, d5x1bt_, d5x1bu_, d5x1bv_, d5x1bw_, d5x1bx_, d5x1by_, d5x1bz_ |