Lineage for d5x1fu_ (5x1f U:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000510Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2000511Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 2000512Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 2000513Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 2000514Species Cow (Bos taurus) [TaxId:9913] [47697] (19 PDB entries)
  8. 2000542Domain d5x1fu_: 5x1f U: [337758]
    Other proteins in same PDB: d5x1fa_, d5x1fb1, d5x1fb2, d5x1fc_, d5x1fd_, d5x1fe_, d5x1ff_, d5x1fg_, d5x1fi_, d5x1fj_, d5x1fk_, d5x1fl_, d5x1fm_, d5x1fn_, d5x1fo1, d5x1fo2, d5x1fp_, d5x1fq_, d5x1fr_, d5x1fs_, d5x1ft_, d5x1fv_, d5x1fw_, d5x1fx_, d5x1fy_, d5x1fz_
    automated match to d1v54h_
    complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5x1fu_

PDB Entry: 5x1f (more details), 2.2 Å

PDB Description: co bound cytochrome c oxidase without pump laser irradiation at 278k
PDB Compounds: (U:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d5x1fu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x1fu_ a.51.1.1 (U:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOPe Domain Coordinates for d5x1fu_:

Click to download the PDB-style file with coordinates for d5x1fu_.
(The format of our PDB-style files is described here.)

Timeline for d5x1fu_: