SCOPe 2.06: Domain d5x1bf_: 5x1b F:

Lineage for d5x1bf_ (5x1b F:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families)

5. Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins)
   membrane-anchored rubredoxin-like domain
   automatically mapped to Pfam PF01215

6. Protein Cytochrome c oxidase Subunit F [57819] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57820] (35 PDB entries)

8. Domain d5x1bf_: 5x1b F: [337756]
   Other proteins in same PDB: d5x1ba_, d5x1bb1, d5x1bb2, d5x1bc_, d5x1bd_, d5x1be_, d5x1bg_, d5x1bh_, d5x1bi_, d5x1bj_, d5x1bk_, d5x1bl_, d5x1bm_, d5x1bn_, d5x1bo1, d5x1bo2, d5x1bp_, d5x1bq_, d5x1br_, d5x1bt_, d5x1bu_, d5x1bv_, d5x1bw_, d5x1bx_, d5x1by_, d5x1bz_
   automated match to d3ag3f_
   complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5x1bf_

PDB Entry: 5x1b, 2.4 Å

PDB Description: co bound cytochrome c oxidase at 20 nsec after pump laser irradiation to release co from o2 reduction center

PDB Compounds: (F:) cytochrome c oxidase subunit 5b, mitochondrial

SCOPe Domain Sequences for d5x1bf_:

Sequence; same for both SEQRES and ATOM records:

>d5x1bf_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

Timeline for d5x1bf_:

• d5x1bf_ is new in SCOPe 2.06-stable
  
• d5x1bf_ appears in SCOPe 2.07
  
• d5x1bf_ appears in the current release, SCOPe 2.08