SCOPe 2.06: Domain d5xecc_: 5xec C:

Lineage for d5xecc_ (5xec C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein automated matches [190113] (17 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [337705] (2 PDB entries)

8. Domain d5xecc_: 5xec C: [337755]
   automated match to d1ynra_
   complexed with hec

Details for d5xecc_

PDB Entry: 5xec, 1.1 Å

PDB Description: heterodimer constructed from pa cyt c551-ht cyt c552 and ht cyt c552- pa cyt c551 chimeric proteins

PDB Compounds: (C:) Cytochrome c-552,Cytochrome c-551

SCOPe Domain Sequences for d5xecc_:

Sequence; same for both SEQRES and ATOM records:

>d5xecc_ a.3.1.1 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
neqlakqkgcmachdlkakmvgpaykdvaakfagqagaeaelaqrikngsqgvwgpipmp
pnavsddeaqtlakwvlsqk

Timeline for d5xecc_:

• d5xecc_ is new in SCOPe 2.06-stable
  
• d5xecc_ appears in SCOPe 2.07
  
• d5xecc_ appears in the current release, SCOPe 2.08