Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) |
Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins) |
Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [81454] (45 PDB entries) |
Domain d5x1fo1: 5x1f O:1-90 [337743] Other proteins in same PDB: d5x1fa_, d5x1fb2, d5x1fc_, d5x1fd_, d5x1fe_, d5x1ff_, d5x1fg_, d5x1fh_, d5x1fi_, d5x1fj_, d5x1fk_, d5x1fl_, d5x1fm_, d5x1fn_, d5x1fo2, d5x1fp_, d5x1fq_, d5x1fr_, d5x1fs_, d5x1ft_, d5x1fu_, d5x1fv_, d5x1fw_, d5x1fx_, d5x1fy_, d5x1fz_ automated match to d1v54b2 complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5x1f (more details), 2.2 Å
SCOPe Domain Sequences for d5x1fo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x1fo1 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]} maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe vetiwtilpaiililialpslrilymmdei
Timeline for d5x1fo1:
View in 3D Domains from other chains: (mouse over for more information) d5x1fa_, d5x1fb1, d5x1fb2, d5x1fc_, d5x1fd_, d5x1fe_, d5x1ff_, d5x1fg_, d5x1fh_, d5x1fi_, d5x1fj_, d5x1fk_, d5x1fl_, d5x1fm_, d5x1fn_, d5x1fp_, d5x1fq_, d5x1fr_, d5x1fs_, d5x1ft_, d5x1fu_, d5x1fv_, d5x1fw_, d5x1fx_, d5x1fy_, d5x1fz_ |