Lineage for d5x1fn_ (5x1f N:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3026966Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 3026967Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 3026968Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 3027023Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species)
  7. 3027024Species Cow (Bos taurus) [TaxId:9913] [81432] (40 PDB entries)
  8. 3027080Domain d5x1fn_: 5x1f N: [337710]
    Other proteins in same PDB: d5x1fb1, d5x1fb2, d5x1fc_, d5x1fd_, d5x1fe_, d5x1ff_, d5x1fg_, d5x1fh_, d5x1fi_, d5x1fj_, d5x1fk_, d5x1fl_, d5x1fm_, d5x1fo1, d5x1fo2, d5x1fp_, d5x1fq_, d5x1fr_, d5x1fs_, d5x1ft_, d5x1fu_, d5x1fv_, d5x1fw_, d5x1fx_, d5x1fy_, d5x1fz_
    automated match to d1v54a_
    complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5x1fn_

PDB Entry: 5x1f (more details), 2.2 Å

PDB Description: co bound cytochrome c oxidase without pump laser irradiation at 278k
PDB Compounds: (N:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d5x1fn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x1fn_ f.24.1.1 (N:) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]}
mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
evltvdltttnlewlngcpppyhtfeeptyvnlk

SCOPe Domain Coordinates for d5x1fn_:

Click to download the PDB-style file with coordinates for d5x1fn_.
(The format of our PDB-style files is described here.)

Timeline for d5x1fn_: