Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) automatically mapped to Pfam PF02284 |
Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins) |
Protein Cytochrome c oxidase subunit E [48481] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [48482] (49 PDB entries) |
Domain d5x1be_: 5x1b E: [337695] Other proteins in same PDB: d5x1ba_, d5x1bb1, d5x1bb2, d5x1bc_, d5x1bd_, d5x1bf_, d5x1bg_, d5x1bh_, d5x1bi_, d5x1bj_, d5x1bk_, d5x1bl_, d5x1bm_, d5x1bn_, d5x1bo1, d5x1bo2, d5x1bp_, d5x1bq_, d5x1bs_, d5x1bt_, d5x1bu_, d5x1bv_, d5x1bw_, d5x1bx_, d5x1by_, d5x1bz_ automated match to d1ocre_ complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5x1b (more details), 2.4 Å
SCOPe Domain Sequences for d5x1be_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x1be_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
Timeline for d5x1be_:
View in 3D Domains from other chains: (mouse over for more information) d5x1ba_, d5x1bb1, d5x1bb2, d5x1bc_, d5x1bd_, d5x1bf_, d5x1bg_, d5x1bh_, d5x1bi_, d5x1bj_, d5x1bk_, d5x1bl_, d5x1bm_, d5x1bn_, d5x1bo1, d5x1bo2, d5x1bp_, d5x1bq_, d5x1br_, d5x1bs_, d5x1bt_, d5x1bu_, d5x1bv_, d5x1bw_, d5x1bx_, d5x1by_, d5x1bz_ |